DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and endog

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:NP_001019385.1 Gene:endog / 100002293 ZFINID:ZDB-GENE-050522-402 Length:306 Species:Danio rerio


Alignment Length:311 Identity:119/311 - (38%)
Similarity:169/311 - (54%) Gaps:30/311 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KWQLLGLGFVLGVTALCASFVGGMYFQHTDARKRLRE--LIQTDPY--------AYYLSPKIYEV 58
            :|.|.||....|:.      :|.......|.|...|:  |:...|.        |..:||     
Zfish     8 RWVLPGLSLTAGIG------IGATLTAAGDRRNNNRKASLLDRVPVIPIPSVDAASEISP----- 61

  Fly    59 FTFFESNNEDDHRMRQIMKFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCEHLQADSIHPNRGRRG 123
               ::......:|....||:|||.|.:::....:|.|||.|||.|.||.|.|.|:::..:..|: 
Zfish    62 ---YQPGQVSVNRSTAAMKYGFPSLSNIKSRESYVTSYDPRNRTAAWVIEQLNAETVTGSSDRK- 122

  Fly   124 RNPYQPDLSVPSNFRSELSDYRRSGFDRGHLAAAGNHHLQQNHCEDTFFLTNIAPQVGQGFNRSA 188
            ...::.|.||....||..:||:.|||||||||||.||...|...::||:|:|::|| ....|::|
Zfish   123 YCEFKEDESVHVYHRSSNADYKGSGFDRGHLAAAANHKWSQKAMDETFYLSNVSPQ-NPNLNQNA 186

  Fly   189 WNNLEQYVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGLNMVAVPTHFFKVIMVESKLH 253
            |||||:|.|:|...:.:|||||||||.|.|...||..|:|:::|.|.||||||||||:::|..  
Zfish   187 WNNLEKYCRSLTKHYQNVFVCTGPLYLPRQEADGKMYVKYQVLGKNHVAVPTHFFKVVILEKP-- 249

  Fly   254 LGKPYMEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGLKFFDGL--RRSAL 302
            .|...:..||:||.|:.:.:||..||..|..||..:||.|...:  |.|:|
Zfish   250 RGDVELRSYVMPNMPVDEKIPLERFLVPIESIERASGLLFVPNIMKRTSSL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 102/227 (45%)
endogNP_001019385.1 NUC 89..293 CDD:214683 95/207 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1864
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52002
OrthoDB 1 1.010 - - D570297at33208
OrthoFinder 1 1.000 - - FOG0003231
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3743
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.