DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tengl2 and si:ch211-133n4.9

DIOPT Version :9

Sequence 1:NP_722779.1 Gene:Tengl2 / 318044 FlyBaseID:FBgn0052463 Length:318 Species:Drosophila melanogaster
Sequence 2:XP_009292242.1 Gene:si:ch211-133n4.9 / 100000061 ZFINID:ZDB-GENE-070424-126 Length:299 Species:Danio rerio


Alignment Length:275 Identity:62/275 - (22%)
Similarity:97/275 - (35%) Gaps:77/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IYEVFTFFESNNED--DHRMRQIMKFGFPGLDDLRLYSDFVLSYDRRNRVAHWVCE-HLQADSIH 116
            :|...||:.....:  .||:.....:.:.|            ||..|.|:: |:.| .|::..  
Zfish    66 LYTFATFYSIKFSERLPHRIPVFSAYKYTG------------SYKGRPRLS-WMIEPQLESSD-- 115

  Fly   117 PNRGRRGRNPYQPDLSVPSNFRSELSDYRRS---GFDRGHLAAAGNHHLQQNHCEDTFFLTNIAP 178
                       ..::..|...::|..||...   ...||||...| |.......|.||.||||.|
Zfish   116 -----------NSEMRAPCVNQAEAGDYYTKDIYNISRGHLFPNG-HAADNITAESTFTLTNIVP 168

  Fly   179 QVGQGFNRSAWNNLEQYVRNLVHRFGSVFVCTGPLYKPNQRPGGKWAVEYEMIGL---------N 234
            || ..||..:|..:||.||:::..     .|       ..|...:..:.|.:.|.         .
Zfish   169 QV-TSFNNGSWVRMEQKVRSIIES-----DC-------RDRNNPEKTLAYVLTGAVPSKSNFLRK 220

  Fly   235 MVAVPTHFFKVIMV--------ESKLHLGKPYMEGYVLPNAPIPDGLPLRSFLCDIREIEHYAGL 291
            .|.:|||.:.....        .|:.|.|:...||.       |..:|.||    :.::|.:...
Zfish   221 RVNIPTHMWTAFCCYNSTGHTWVSQAHWGENKREGN-------PIDIPTRS----LDKLEQFLKK 274

  Fly   292 KFFDGLRRSALFGSN 306
            ::   .|...||.:|
Zfish   275 QY---NRNYKLFKNN 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tengl2NP_722779.1 Endonuclease_NS 74..300 CDD:279553 54/246 (22%)
si:ch211-133n4.9XP_009292242.1 Endonuclease_NS 71..279 CDD:214889 57/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933605at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.