DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32461 and rundc1

DIOPT Version :10

Sequence 1:NP_730770.1 Gene:CG32461 / 318042 FlyBaseID:FBgn0052461 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_003198160.1 Gene:rundc1 / 100537899 ZFINID:ZDB-GENE-100311-1 Length:568 Species:Danio rerio


Alignment Length:157 Identity:43/157 - (27%)
Similarity:69/157 - (43%) Gaps:27/157 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 INSEEQNVAVSG----WTKSNSPELIEEERLYTELDS------EGRMISRTMTPYECQLEGEVEQ 58
            :::.:...|.:|    |....:....|:|...|...:      :|.|:||..     ::|.|.||
Zfish     6 LSTSDSEAAFAGAGERWAPVGAVANPEDEHWKTGAQAGSVSSGDGEMVSRLR-----KMEDEQEQ 65

  Fly    59 LQEALFKISSHYAKVQFGLRQISLASGSERENLLKDLERLIAKGLDATGPIRG------------ 111
            |..:|..::||:|:|||.|:||..|...|:|.:|.:||....:|.......|.            
Zfish    66 LNSSLLALTSHFAQVQFRLKQIVHAQSDEKERMLLELEEFAFRGCPHVVGCRAQDAHMLENSSER 130

  Fly   112 EKFSMPAKLRVKQDKILCQLRGSLGDL 138
            ||.......|.||.:::.||:..|.||
Zfish   131 EKRERLEAQRNKQKELIFQLKNQLDDL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32461NP_730770.1 None
rundc1XP_003198160.1 PRK12704 119..>240 CDD:237177 10/39 (26%)
RUN_RUNDC1 224..553 CDD:439045
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.