DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ACA5

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_172285.2 Gene:ACA5 / 837324 AraportID:AT1G08065 Length:277 Species:Arabidopsis thaliana


Alignment Length:249 Identity:70/249 - (28%)
Similarity:112/249 - (44%) Gaps:62/249 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQSPIEISNR--AIEHIDDVDPLEY-HGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQ 64
            :||||:::::  .|:|     .|.| ...:.|.. |.::|.|...|:.|......   :|..:..
plant    63 MQSPIDLTDKRVLIDH-----NLGYLRSQYLPSN-ATIKNRGHDIMMKFEGGNAG---LGITING 118

  Fly    65 DMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQAC 129
            ..|..:|:|:|      |..||||.|.::.:|.|.||.:.      :.:|     ||||||.: .
plant   119 TEYKLQQIHWH------SPSEHTLNGKRFVLEEHMVHQSK------DGRN-----AVVAFFYK-L 165

  Fly   130 GEKDCPEF---------KKIT---EGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTT 182
            |:   |::         |:||   |....|:.:|...         .|.:  |||||.:.|||||
plant   166 GK---PDYFLLTLERYLKRITDTHESQEFVEMVHPRT---------FGFE--SKHYYRFIGSLTT 216

  Fly   183 APYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKDP 236
            .|..|:|.|.|.:....|:..|:.:   |:....|:|.   :|.|.:||.::.|
plant   217 PPCSENVIWTISKEMRTVTLKQLIM---LRVTVHDQSN---SNARPLQRKNERP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 69/243 (28%)
ACA5NP_172285.2 PLN02179 9..231 CDD:177835 60/208 (29%)
alpha_CA_prokaryotic_like 44..265 CDD:239398 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.