DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ACA8

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_200444.1 Gene:ACA8 / 835733 AraportID:AT5G56330 Length:350 Species:Arabidopsis thaliana


Alignment Length:198 Identity:54/198 - (27%)
Similarity:84/198 - (42%) Gaps:53/198 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMY 67
            :||||::.::.:...:....|  ...:.|.... ::|.|...|:.|....:.   ||..:....|
plant   168 MQSPIDLRDKNVVVSNKFGLL--RSQYLPSNTT-IKNRGHDIMLKFKGGNKG---IGVTIRGTRY 226

  Fly    68 VFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGEK 132
            ..:|||:|      |..|||:.|.::::|.|.||         |:|:|  ..|||| |:...|..
plant   227 QLQQLHWH------SPSEHTINGKRFALEEHLVH---------ESKDK--RYAVVA-FLYNLGAS 273

  Fly   133 DCP-------EFKKIT------EGIRIVQK---------IHTSASLDSDCLSWIGLQELSKH-YY 174
            | |       :.||||      |.||.|..         :|.::  ||:...   ||.::|. .|
plant   274 D-PFLFSLEKQLKKITDTHASEEHIRTVSSKQVKLLRVAVHDAS--DSNARP---LQAVNKRKVY 332

  Fly   175 TYK 177
            .||
plant   333 LYK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 54/197 (27%)
ACA8NP_200444.1 alpha_CA_prokaryotic_like 149..333 CDD:239398 51/194 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.