DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ACA3

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_196038.1 Gene:ACA3 / 830296 AraportID:AT5G04180 Length:277 Species:Arabidopsis thaliana


Alignment Length:253 Identity:62/253 - (24%)
Similarity:92/253 - (36%) Gaps:85/253 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSK-----RKQQPYIIGGALE 63
            ||||.::.:                     :||:.:..|..:.|:.|     .|.:.:.:....|
plant    55 QSPINLTPK---------------------IARIVHNSTEILQTYYKPVEAILKNRGFDMKVKWE 98

  Fly    64 QDM---------YVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGL 119
            .|.         |...|.|:|      :..||.|:|.:.:||.|.||           |:....|
plant    99 DDAGKIVINDTDYKLVQSHWH------APSEHFLDGQRLAMELHMVH-----------KSVEGHL 146

  Fly   120 AVVAFFIQACGEKDCPEFKKITEGIRIVQKIHTSA----------SLDSDCLSWIGLQELSKHYY 174
            ||:....:. ||.:.  |..     ||:.|||..|          .:|.....|    :|:| :|
plant   147 AVIGVLFRE-GEPNA--FIS-----RIMDKIHKIADVQDGEVSIGKIDPREFGW----DLTK-FY 198

  Fly   175 TYKGSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRP 232
            .|:|||||.|..|.|.|.|......|||.|:.|..:.:.          ..|.:..||
plant   199 EYRGSLTTPPCTEDVMWTIINKVGTVSREQIDVLTDARR----------GGYEKNARP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 62/253 (25%)
ACA3NP_196038.1 alpha_CA_prokaryotic_like 35..257 CDD:239398 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.