DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ACA6

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_193832.1 Gene:ACA6 / 827847 AraportID:AT4G21000 Length:260 Species:Arabidopsis thaliana


Alignment Length:200 Identity:57/200 - (28%)
Similarity:85/200 - (42%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGG--ALEQD 65
            :||||::::..:..|.|   .....|::|.. |.:|:.|...||::...       ||  .:.|.
plant    65 IQSPIDLTDERVSLIHD---QALSKHYKPAS-AVIQSRGHDVMVSWKGD-------GGKITIHQT 118

  Fly    66 MYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACG 130
            .|...|.|:|      |..|||:.|..|.:|.|.||        |.|..|    ..|...:...|
plant   119 DYKLVQCHWH------SPSEHTINGTSYDLELHMVH--------TSASGK----TTVVGVLYKLG 165

  Fly   131 EKDCPEF-KKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIY 194
            |.|  || .||..||:.|.|    ..:|...:....::..:.::|.|.||||..|..|.|.|.:.
plant   166 EPD--EFLTKILNGIKGVGK----KEIDLGIVDPRDIRFETNNFYRYIGSLTIPPCTEGVIWTVQ 224

  Fly   195 RTPIY 199
            :..:|
plant   225 KRVLY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 56/198 (28%)
ACA6NP_193832.1 PLN02179 1..235 CDD:177835 56/199 (28%)
alpha_CA_prokaryotic_like 46..225 CDD:239398 56/194 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.