DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Ca14

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001103125.1 Gene:Ca14 / 791259 RGDID:1599277 Length:337 Species:Rattus norvegicus


Alignment Length:243 Identity:72/243 - (29%)
Similarity:116/243 - (47%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGH----WEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQ 64
            ||||:|....:....|:..::.||:    .||:.   :.|.|.:..::.     .|.:..|.|.:
  Rat    45 QSPIDIQTDGVIFDPDLPTVQPHGYDQLGTEPLD---LHNNGHTVQLSL-----PPTLHLGGLPR 101

  Fly    65 DMYVFEQLHFHWSDCDE-SGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFIQ 127
             .|...|||.||..... .|.||.:.....:.|.|.|||:|: |...:||..||.||||:...|:
  Rat   102 -KYTAAQLHLHWGQKGTLKGSEHQINSEATAAELHVVHYDSESYGSLSEAAQKPQGLAVLGILIE 165

  Fly   128 ACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWI 192
            . ||.:.|.:..|...:..|:......|:....:..:..|:| :.::.|.|||||.|.::||.|.
  Rat   166 V-GETENPAYDHILSHLHEVRYKDQKTSVPPFNVRELLPQQL-EQFFRYNGSLTTPPCYQSVLWT 228

  Fly   193 IYRTPIYVSRGQVQVFR-NLQSCPKDESKKIVNNYREIQRPHKDPEIF 239
            ::.....:|.||::..: .|.|..:|.|:.:|.||| :.:|.....||
  Rat   229 VFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYR-VPQPLNQRTIF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 69/235 (29%)
Ca14NP_001103125.1 alpha_CA_XII_XIV 29..278 CDD:239400 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.