powered by:
Protein Alignment CAH3 and ca6
DIOPT Version :9
Sequence 1: | NP_001259349.1 |
Gene: | CAH3 / 31804 |
FlyBaseID: | FBgn0030056 |
Length: | 250 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001072482.1 |
Gene: | ca6 / 779937 |
XenbaseID: | XB-GENE-494019 |
Length: | 121 |
Species: | Xenopus tropicalis |
Alignment Length: | 62 |
Identity: | 34/62 - (54%) |
Similarity: | 44/62 - (70%) |
Gaps: | 3/62 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 MYVFEQLHFHWS--DCDESGCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVAF 124
:|...|:|.||. :.:.||.|||::||:|..|.|.||||| .||.|.|||:||:||||:||
Frog 10 LYTAVQMHLHWGGLESETSGSEHTIDGMRYLAELHVVHYNSGTYKTFDEAKDKPNGLAVLAF 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1377476at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000047 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.