DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CA11

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001208.2 Gene:CA11 / 770 HGNCID:1370 Length:328 Species:Homo sapiens


Alignment Length:273 Identity:62/273 - (22%)
Similarity:114/273 - (41%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNT--GTSAMVTFSKRKQQPYIIGGALEQDM 66
            |||:::..:.:.:...:.||..     ..|..:::.|  .|...|:|....:....:.|......
Human    68 QSPVDVELKRVLYDPFLPPLRL-----STGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYS 127

  Fly    67 YVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFIQACG 130
            :...:|...:...|.:|.||.:....:|.|...:|:|.: |.:|:.|...|:|||:::.|:....
Human   128 HRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVAS 192

  Fly   131 EKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIG-------LQELSKH--------YYTYKGSL 180
            ..: |...::               |:.|.::.|.       ||:||..        :.||:|||
Human   193 TSN-PFLSRL---------------LNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSL 241

  Fly   181 TTAPYFESVTWIIYRTPIYVSRGQVQVFRNL-QSCPKDESKKIVNNYREIQ-------RPHKDPE 237
            :|.|..|:||||:....:.::..|:...|.| |:.|....:.:..|.|.:|       |.::||.
Human   242 STPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPR 306

  Fly   238 IFFARNTNPKSKL 250
            ....|...|..:|
Human   307 HPERRCRGPNYRL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 57/254 (22%)
CA11NP_001208.2 alpha_CARP_X_XI_like 48..304 CDD:239395 57/256 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..328 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.