DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and zgc:153760

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001070086.1 Gene:zgc:153760 / 767680 ZFINID:ZDB-GENE-060929-528 Length:324 Species:Danio rerio


Alignment Length:242 Identity:72/242 - (29%)
Similarity:107/242 - (44%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||:|....::...::......|.........:.|:|||.:|:..:....  :.||.| ..:||
Zfish    51 QSPIDIVTAQVQGNPNLTQFILTGFDANTTFTSITNSGTSVVVSLDEDIMS--VQGGDL-PGLYV 112

  Fly    69 FEQLHFHW-SDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTE---AKNKPDGLAVVAFFIQAC 129
            ..|.|.|| |.....|.|||::|.:|:||.|.|:.:|.|.....   |.|....|||:.|||:..
Zfish   113 SVQFHLHWGSSSSLPGSEHTVDGKQYAMELHIVNLHSTYNGNVSAALAANDSSALAVLGFFIEGT 177

  Fly   130 GEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQEL-----SKHYYTYKGSLTTAPYFESV 189
            .|.|......:...  .:..|..|.:..:|.:..|.:..|     ...||.|:|||||.|..|.|
Zfish   178 DEADKTNSWDVFTS--FLSNIPNSGNTYTDIMDQITMNSLLEGVNKTKYYRYQGSLTTPPCNEDV 240

  Fly   190 TWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKI------VNNYREIQ 230
            .|.:::.||.|:...:..|     |.|..:|..      |||:|.:|
Zfish   241 IWTVFKEPIKVNNNLINRF-----CTKVFAKTAKASDLNVNNFRGVQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 72/242 (30%)
zgc:153760NP_001070086.1 alpha_CA_IV_XV_like 48..291 CDD:239391 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.