DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CA8

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:219 Identity:70/219 - (31%)
Similarity:110/219 - (50%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGV----ARVQNTGTSAMVTFSKRKQQPYIIGGALEQ 64
            ||||.:::|...:    ||........|..|    ..|.|.|.:..|..   |.:..:.||.|.|
Human    49 QSPINLNSREARY----DPSLLDVRLSPNYVVCRDCEVTNDGHTIQVIL---KSKSVLSGGPLPQ 106

  Fly    65 DMYVFE--QLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFI 126
            . :.||  ::.|||...::.|.|||:....:.||.|.:|:||. :....||..||.|:|::|.|:
Human   107 G-HEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFV 170

  Fly   127 QACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGL--QELSKHYYTYKGSLTTAPYFESV 189
            |.  .|:....|.:||.::.:|  :...|....|.:...|  ..|.:.|:.|:||||..|..|.|
Human   171 QI--GKEHVGLKAVTEILQDIQ--YKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGV 231

  Fly   190 TWIIYRTPIYVSRGQVQVFRNLQS 213
            |||::|.|:.:|:.|::.||.|::
Human   232 TWILFRYPLTISQLQIEEFRRLRT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 70/219 (32%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
alpha_CARP_VIII 35..289 CDD:239394 70/219 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.