DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CA7

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_005173.1 Gene:CA7 / 766 HGNCID:1381 Length:264 Species:Homo sapiens


Alignment Length:229 Identity:86/229 - (37%)
Similarity:122/229 - (53%) Gaps:9/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||.|.:....:...:.|||.  .:|......:.|.|.|..|.|:....:..:.||.|| ..|.
Human    30 QSPINIISSQAVYSPSLQPLEL--SYEACMSLSITNNGHSVQVDFNDSDDRTVVTGGPLE-GPYR 91

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVAFFIQACGEK 132
            .:|.||||....:.|.|||::|..:..|.|.||:|: ||..|.||.:.|||||||..|::...|.
Human    92 LKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAPDGLAVVGVFLETGDEH 156

  Fly   133 DCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYRTP 197
              |...::|:.:.:|:...|.|..  .|.:...|...|:||:||.|||||.|..||||||:.|.|
Human   157 --PSMNRLTDALYMVRFKGTKAQF--SCFNPKCLLPASRHYWTYPGSLTTPPLSESVTWIVLREP 217

  Fly   198 IYVSRGQVQVFRNLQSCPKDESK-KIVNNYREIQ 230
            |.:|..|:..||:|....:|:.: .:|||:|..|
Human   218 ICISERQMGKFRSLLFTSEDDERIHMVNNFRPPQ 251

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 86/229 (38%)
CA7NP_005173.1 alpha_CA_VII 27..262 CDD:239402 86/229 (38%)