DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CA4

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005257696.1 Gene:CA4 / 762 HGNCID:1375 Length:336 Species:Homo sapiens


Alignment Length:260 Identity:73/260 - (28%)
Similarity:115/260 - (44%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGH-----WEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALE 63
            ||||.|.....:....:....:.|:     |      .|||.|.|.|:....:..   |.||.|.
Human    51 QSPINIVTTKAKVDKKLGRFFFSGYDKKQTW------TVQNNGHSVMMLLENKAS---ISGGGLP 106

  Fly    64 QDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK--YKDFTEAKNKPDGLAVVAFFI 126
            .. |..:|||.||||....|.||:|:|..::||.|.||...|  .::..||::..|.:||:||.:
Human   107 AP-YQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLV 170

  Fly   127 QACGEKDCPE------------------------FKKITEGIRIVQKIHTSASL-DSDCLSWIGL 166
            : .|..:.|.                        |:.:.|.:..:.|...|.:: :|..|..:..
Human   171 E-IGRMNWPPPLAPCRLSQDPSLPFQAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPK 234

  Fly   167 QELSKHYYTYKGSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQR 231
            :|..:||:.|.|||||....|.|.|.::|.||.:.|.|:..|.......|:::..:.:|.|.:|:
Human   235 EEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQ 299

  Fly   232  231
            Human   300  299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 73/260 (28%)
CA4XP_005257696.1 alpha_CA_IV_XV_like 48..307 CDD:239391 73/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.