DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and PTPRG

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_016862450.1 Gene:PTPRG / 5793 HGNCID:9671 Length:1485 Species:Homo sapiens


Alignment Length:284 Identity:68/284 - (23%)
Similarity:110/284 - (38%) Gaps:67/284 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGH--------WEPVGVARVQNTGTSAMVTFSKRKQQPYIIGG 60
            ||||:|.::.....::...|:..|.        |       ::|||.:..:..    :..|.:.|
Human    83 QSPIDILDQYARVGEEYQELQLDGFDNESSNKTW-------MKNTGKTVAILL----KDDYFVSG 136

  Fly    61 ALEQDMYVFEQLHFHWSDCDES-GCEHTLEGMKYSMEA----------------HAVHYNSKYKD 108
            |.....:..|::.|||...:.| |.||::.|.::.:||                ..:....|.:.
Human   137 AGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEAEDARGGDIMLMLSQGMRFILLGLKKEQ 201

  Fly   109 FTEAKN------------KPDG-------------LAVVAFFIQACGEKDCPEFKKITEGIRIVQ 148
            |.|.|:            .||.             :..:|.|.|. ..:|......|..|::.|.
Human   202 FEERKSWTTYQSMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQV-SPRDNSALDPIIHGLKGVV 265

  Fly   149 KIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQS 213
            .......||...|..:....|.. ||.|.|||||.|..|.|.||::|.|:.:|..|::.|.::.:
Human   266 HHEKETFLDPFVLRDLLPASLGS-YYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFT 329

  Fly   214 CPKDESKKIV----NNYREIQRPH 233
            ..:.:..|.|    ||:|..||.|
Human   330 TEQQDHVKSVEYLRNNFRPQQRLH 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 67/282 (24%)
PTPRGXP_016862450.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.