DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CA10

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001076002.1 Gene:CA10 / 56934 HGNCID:1369 Length:328 Species:Homo sapiens


Alignment Length:232 Identity:65/232 - (28%)
Similarity:109/232 - (46%) Gaps:12/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            |||:.|....:.....:.||..:.....|. ..:.|||....:...| :....|.||.:... :.
Human    66 QSPVNIETSHMIFDPFLTPLRINTGGRKVS-GTMYNTGRHVSLRLDK-EHLVNISGGPMTYS-HR 127

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFIQACGEK 132
            .|::..|:...|..|.||.|.|..:|.|...:|||.: |.:.|||...|:||.||:.||:. .:.
Human   128 LEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKV-SDS 191

  Fly   133 DCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQEL---SKHYYTYKGSLTTAPYFESVTWIIY 194
            ..|...::.....|.:..:.:   |:..|..:.::||   :..:.||.||:|..|.:|:.:|||.
Human   192 SNPFLNRMLNRDTITRITYKN---DAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIM 253

  Fly   195 RTPIYVSRGQVQVFRNL-QSCPKDESKKIVNNYREIQ 230
            ..|:|::|.|:...|.| |:.|......:.:|:|.:|
Human   254 NKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQ 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 65/232 (28%)
CA10NP_001076002.1 alpha_CARP_X_XI_like 46..302 CDD:239395 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.