DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca16b

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_001919055.3 Gene:ca16b / 569183 ZFINID:ZDB-GENE-080818-1 Length:1382 Species:Danio rerio


Alignment Length:236 Identity:66/236 - (27%)
Similarity:109/236 - (46%) Gaps:11/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVAR--VQNTGTSAMVTFSKRKQQPYIIGGALEQDM 66
            |||::|.:...:...:...|...| :|.....|  ::|||.:..:..    :..|.:.||.....
Zfish    78 QSPVDILDPETQVSQECQELTLDG-FETKSSNRTTMKNTGKTVSIVL----KNDYFVRGAGLPGR 137

  Fly    67 YVFEQLHFHWSDCDES-GCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVAFFIQAC 129
            :..|::.|||...:.| |.||::.|.|:.:|.....||| .:...:.|..:...:|.:|.|.|. 
Zfish   138 FKAEKVEFHWGSTNGSAGSEHSINGKKFPVEMQIYFYNSDDFDSLSTAIKERRIIAAMAVFFQV- 201

  Fly   130 GEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIY 194
            ..||....:.|..|::.|.......:|.|..|..:....|.. ||.|.|||||.|..:.|.|||:
Zfish   202 ATKDNIAAEPIIAGLKRVVHHEKETNLGSFILRDLLPSSLGS-YYRYTGSLTTPPCSKVVEWIIF 265

  Fly   195 RTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKD 235
            ..|:|:|..|::.|.::.:..:.:..|.|:..|...||.:|
Zfish   266 SRPVYLSYHQLEAFYSIFTTEQQDHVKSVDYLRNNHRPIQD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 64/232 (28%)
ca16bXP_001919055.3 alpha_CARP_receptor_like 62..314 CDD:239396 66/236 (28%)
FN3 340..417 CDD:214495
Herpes_BLLF1 450..>557 CDD:330317
PTPc 790..1057 CDD:214550
PTPc 1089..1347 CDD:214550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.