DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and car15

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005169278.1 Gene:car15 / 568143 ZFINID:ZDB-GENE-091204-152 Length:312 Species:Danio rerio


Alignment Length:261 Identity:74/261 - (28%)
Similarity:119/261 - (45%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SPIEISNRAIEHIDDVDPLEYHGH--------WEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGA 61
            |||.:.:..::: ..:|.|:.||.        |       :.|.|.|.::......|   :.||.
Zfish    50 SPINLDHHLMKN-HSLDSLQLHGFNLTHKGQWW-------LTNQGHSVVLEVGDGMQ---VSGGG 103

  Fly    62 LEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFI 126
            |......| ||||||.....:|.||||:.:::.||.|.|:..|.:.:.|.|...|.|:||:..|:
Zfish   104 LPATYRTF-QLHFHWGSVSSNGSEHTLDHLRFPMEMHIVNIKSTHPNLTSALEDPTGIAVLGVFV 167

  Fly   127 QACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTW 191
            ......: ..|:.|:..:..|.....:.|:....|..:..|.....||.|.|||||.|..|.|.|
Zfish   168 DVTYLHN-ENFQSISSALSYVAYKGQTKSIKPFPLVNLLPQNNLTQYYRYHGSLTTPPCSEVVLW 231

  Fly   192 IIYRTPIYVSRGQVQVFRNLQSCPKDESK---KIVNNYREIQRPHKDPEIFFARN----TNPKSK 249
            .||..|:|:|..|.:.|.:.....::|::   .:.:|||.|...:..| ::.:::    ||..|.
Zfish   232 TIYEVPVYISWAQFEQFVSGIYSTEEEAEIQALLHDNYRHIHPTYSRP-VYASKDAKLLTNGVSS 295

  Fly   250 L 250
            |
Zfish   296 L 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 69/238 (29%)
car15XP_005169278.1 alpha_CA_IV_XV_like 46..282 CDD:239391 70/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.