DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca7

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_957107.1 Gene:ca7 / 564201 ZFINID:ZDB-GENE-040426-1786 Length:263 Species:Danio rerio


Alignment Length:242 Identity:84/242 - (34%)
Similarity:121/242 - (50%) Gaps:34/242 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLE--YHGHWEPVGVA-------RVQNTGTSAMVTFSKRKQQPYIIG 59
            ||||           |:.|.|  :.....|:.::       .:.|.|.|.:|.|....::..|.|
Zfish    29 QSPI-----------DIVPSEAVFDSKLSPISLSYNNCTSLSISNNGHSVVVEFVDTDERSVITG 82

  Fly    60 GALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYN-SKYKDFTEAKNKPDGLAVVA 123
            |.|| :||..:|.||||......|.|||:.|..:..|.|.||:| :|||.|:||...||||||:.
Zfish    83 GPLE-NMYRLKQFHFHWGSKGCCGSEHTVAGKTFVSELHLVHWNANKYKSFSEAAAAPDGLAVLG 146

  Fly   124 FFIQACGEKDCPEFKKITEGIRIVQ---KIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPY 185
            .|::...|...  ..:||:.:.:|:   .:......:..||....|:     |:||.|||||.|.
Zfish   147 IFLETGDEHRA--LHQITDALYMVRFKGSLAEFKGFNPKCLLPNSLE-----YWTYPGSLTTPPL 204

  Fly   186 FESVTWIIYRTPIYVSRGQVQVFRNL--QSCPKDESKKIVNNYREIQ 230
            :||||||:.:.|||||..|:..||.|  ....:::..::.||||..|
Zfish   205 YESVTWIVLKEPIYVSEKQMGKFRTLLFNGEEEEDRNRMENNYRPPQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 84/242 (35%)
ca7NP_957107.1 alpha_CA_VII 26..262 CDD:239402 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.