DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ptprga

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001316793.1 Gene:ptprga / 561197 ZFINID:ZDB-GENE-101101-4 Length:1414 Species:Danio rerio


Alignment Length:246 Identity:69/246 - (28%)
Similarity:110/246 - (44%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNR----AIEH----IDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGG 60
            ||||.|:::    ::|:    :|..|.       |......::|||.:..: |.|   ..|.:.|
Zfish    83 QSPINIADQDTKVSMEYQELTLDGFDA-------ESSNKTSMKNTGKTVAI-FLK---DDYFVRG 136

  Fly    61 ALEQDMYVFEQLHFHWSDCDES-GCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVA 123
            |.....:..|::.|||...:.| |.||::.|.::.:|.....||| .:.....|..:...:|.:|
Zfish   137 AGLPGRFKAEKVEFHWGQSNGSDGSEHSINGRRFPVEMQIFMYNSDDFDSLNTAIREKRVIAAMA 201

  Fly   124 FFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCL-----SWIGLQELSKHYYTYKGSLTTA 183
            .|.|. ..||.|....|..|:|.|........|:...|     |.||      .||.|.|||||.
Zfish   202 VFFQV-DFKDNPAVDPIIHGLRGVVHHEKETFLEPFVLRDLLPSSIG------SYYRYIGSLTTP 259

  Fly   184 PYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIV----NNYREIQ 230
            |..:.|.||::..|:.:|..|::.|.::.:..:.:..|.|    ||:|.:|
Zfish   260 PCSKVVEWIVFSRPVLLSYKQLEAFYSIFTTEQQDHVKSVEYLRNNFRPLQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 69/246 (28%)
ptprgaNP_001316793.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.