DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca4b

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001159683.1 Gene:ca4b / 553246 ZFINID:ZDB-GENE-080815-5 Length:304 Species:Danio rerio


Alignment Length:240 Identity:68/240 - (28%)
Similarity:109/240 - (45%) Gaps:10/240 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||.|..........:.|:::..:.|.:. |.:.|.|.:..:....|.:    |.||.....|.
Zfish    52 QSPINIVTNKASTDSRLTPVQFTDYQERLN-AVIVNNGHTVQINLPDRAK----INGANLGSTYK 111

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGEKD 133
            .:|||.||......|.|||::|.|:.||.|.||...:|....:|.....|:||:.||.:. .|..
Zfish   112 AQQLHLHWGKNGGPGSEHTIDGEKFPMELHVVHIKEEYNSLEQAVGDSSGVAVLGFFYEE-SENA 175

  Fly   134 CPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYRTPI 198
            ...:..|...:..:....::|.|.:..|..:...|....|:.|:|||||....|:|.|.|:...|
Zfish   176 NKNYDAIINSLTNITHPESNAELGAISLDMLIPNEDLDKYFRYEGSLTTPGCAEAVVWTIFEKTI 240

  Fly   199 YVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKDPEIFFARN 243
            .:|:.|:..|.||..   .:...:||.:|.||.....| ::::|:
Zfish   241 PLSKEQLSAFSNLTF---SDGAAMVNTFRPIQLRFDRP-VYYSRS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 66/228 (29%)
ca4bNP_001159683.1 alpha_CA_IV_XV_like 50..278 CDD:239391 67/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.