DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Ca3

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_062165.2 Gene:Ca3 / 54232 RGDID:2241 Length:260 Species:Rattus norvegicus


Alignment Length:234 Identity:77/234 - (32%)
Similarity:115/234 - (49%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            |||||:..:.|.|...:.|  :...::|.....:.|.|.:..|.|.....:..:.||.| ...|.
  Rat    28 QSPIELHTKDIRHDPSLQP--WSVSYDPGSAKTILNNGKTCRVVFDDTFDRSMLRGGPL-SGPYR 89

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGEKD 133
            ..|.|.||...|:.|.|||::|:||:.|.|.||:|.||..|.||..:|||:|||..|::...||.
  Rat    90 LRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKG 154

  Fly   134 CPEFKKITEGIRIVQKIHTSAS------LDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWI 192
              ||:.:.:.:   .||.|...      .|..||.     ...:.|:||.||.||.|..|.:.|:
  Rat   155 --EFQILLDAL---DKIKTKGKEAPFNHFDPSCLF-----PACRDYWTYHGSFTTPPCEECIVWL 209

  Fly   193 IYRTPIYVSRGQVQVFRNLQSCPKDESK-KIVNNYREIQ 230
            :.:.|:.||..|:...|:|.:..::|.. .:|.|:|..|
  Rat   210 LLKEPMTVSSDQMAKLRSLFASAENEPPVPLVGNWRPPQ 248

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 77/234 (33%)
Ca3NP_062165.2 alpha_CA_I_II_III_XIII 1..259 CDD:239393 77/234 (33%)
Involved in proton transfer. /evidence=ECO:0000250 64..67 0/2 (0%)