DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH5

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001097988.2 Gene:CAH5 / 50102 FlyBaseID:FBgn0040629 Length:302 Species:Drosophila melanogaster


Alignment Length:237 Identity:68/237 - (28%)
Similarity:107/237 - (45%) Gaps:43/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVQSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDM 66
            |:|:|:.|:|              :||             |:.||....|..|...|.|:|....
  Fly    88 PLQTPLVITN--------------NGH-------------TANMVIPQTRGGQRPSINGSLLPGN 125

  Fly    67 YVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGE 131
            :..:.:||||...:..|.||.:...:|.:|.|.||.|:.|:...||...||||||:....:|...
  Fly   126 FEAQSVHFHWGSREAKGSEHAINFQRYDVEMHIVHKNTIYETMGEATMHPDGLAVLGVMFRAVDR 190

  Fly   132 KDCPEF--KKITEGI-RIVQKIHTSASLD-----SDCLSWIGLQELSKHYYTYKGSLTTAPYFES 188
            :....:  .||...: |||| .:::|::.     ...|..|    ::..::||.|||||....|:
  Fly   191 QTSQHYGLNKIFNQLPRIVQ-YNSNATITGRLTVGQLLGNI----VTGEFFTYNGSLTTPDCAEA 250

  Fly   189 VTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQ 230
            |||.::...:...|.|:....||:.   ...:.::||||.||
  Fly   251 VTWTVFPDVLDYPRRQITKLWNLRD---SRQRPLINNYRSIQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 67/235 (29%)
CAH5NP_001097988.2 Carb_anhydrase 43..294 CDD:215000 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.