DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH16

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster


Alignment Length:249 Identity:72/249 - (28%)
Similarity:111/249 - (44%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVA------------RVQNTGTSAM----VTFSKRK 52
            ||||.:.:|...            .|...|:.            .::|.|.|..    ||.:.||
  Fly    45 QSPILLDSRTAR------------KWVLPGITFWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRK 97

  Fly    53 QQPYIIGGALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPD 117
              |:|.||.| :..|..:.|||||......|.||.:...::..|.|.||.|.||::..:|..:.|
  Fly    98 --PFITGGRL-KGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKD 159

  Fly   118 GLAVVAFFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQEL-----SKHYYTYK 177
            ||||||..: |...||..:...::..:..|.::....| ::.......|.:|     .:.::||:
  Fly   160 GLAVVAIMV-AIVRKDNAKSTPLSRLMEAVVRVPIEDS-NATVFGQSSLDQLIGGVSHRDFFTYE 222

  Fly   178 GSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDE-SKKIVNNYREIQ 230
            |||||....|:||||::.....|:...|..|..|    :|. ..:::||||.:|
  Fly   223 GSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLL----RDHWGHRLINNYRIVQ 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 72/249 (29%)
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 72/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.