DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Ca13

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001128465.1 Gene:Ca13 / 499566 RGDID:1560453 Length:262 Species:Rattus norvegicus


Alignment Length:235 Identity:85/235 - (36%)
Similarity:125/235 - (53%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||||..:.:::...:.||..  .::|.....:.|:|.|..|.|...:.:..:.||.| ...|.
  Rat    29 QSPIEIKTKEVKYDSSLRPLSI--KYDPASAKIISNSGHSFNVDFDDTEDKSVLRGGPL-TGSYR 90

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVAFFIQACGEK 132
            ..|.|.||...|:.|.||.::|::|:.|.|.||:|| ||..|.||.::.|||||:..|:| .||.
  Rat    91 LRQFHLHWGSADDHGSEHVVDGVRYAAELHVVHWNSDKYPSFVEAAHESDGLAVLGVFLQ-IGEH 154

  Fly   133 DCPEFKKIT---EGIRIVQKIHTSASLDSDCL---SWIGLQELSKHYYTYKGSLTTAPYFESVTW 191
            : |:.:|||   :.|:...|.....:.|..||   ||        .|:||.||||..|..|||||
  Rat   155 N-PQLQKITDILDSIKEKGKQTRFTNFDPLCLLPSSW--------DYWTYPGSLTVPPLLESVTW 210

  Fly   192 IIYRTPIYVSRGQVQVFRNLQSCPKDESKK-IVNNYREIQ 230
            |:.:.||.:|..|:..||:|....:.||.. :::|:|..|
  Rat   211 IVLKQPISISSQQLARFRSLLCTAEGESAAFLLSNHRPPQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 85/235 (36%)
Ca13NP_001128465.1 alpha_CA_I_II_III_XIII 2..261 CDD:239393 85/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.