DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca8

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001011213.1 Gene:ca8 / 496646 XenbaseID:XB-GENE-953676 Length:282 Species:Xenopus tropicalis


Alignment Length:242 Identity:73/242 - (30%)
Similarity:113/242 - (46%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGV----ARVQNTGTSAMVTFSKRKQQPYIIGGALEQ 64
            ||||.|::|...:    ||........|..|    ..|.|.|....:..   |.:..:.||.|.:
 Frog    41 QSPININSREAMY----DPSLLEVRLTPSYVVCRDCEVINDGHVVQILL---KSKSVLKGGPLPR 98

  Fly    65 -DMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFIQ 127
             ..|...::.|||...::.|.|||:....:.||.|.:|:||. |:...||..|..|:.:::.|:|
 Frog    99 GHEYELNEVRFHWGKENQRGSEHTVNFKAFPMELHLIHWNSTLYRSLEEAMGKVHGIVIISLFVQ 163

  Fly   128 ACGEKDCPEFKKITEGIRIVQKI-HTSASLDSDCLSWIGL--QELSKHYYTYKGSLTTAPYFESV 189
            .  .|:....|.|||   ::|.| :...|....|.:...|  ..|.:.|:.|:||||..|..|.|
 Frog   164 I--GKENIGLKAITE---VLQDIFYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTMPPCSEGV 223

  Fly   190 TWIIYRTPIYVSRGQVQVFRNLQS------CPKDESKKIVNNYREIQ 230
            |||::|.|:.||:.|::.||.|::      .|......:.:|:|..|
 Frog   224 TWILFRYPLTVSQTQIEEFRRLRTHIKGADLPDGCDGLMADNFRPTQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 73/242 (30%)
ca8NP_001011213.1 alpha_CARP_VIII 26..281 CDD:239394 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.