DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH6

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001097987.1 Gene:CAH6 / 43701 FlyBaseID:FBgn0039838 Length:298 Species:Drosophila melanogaster


Alignment Length:217 Identity:64/217 - (29%)
Similarity:105/217 - (48%) Gaps:18/217 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GVARVQNTGTSAMVTF--SKRKQQPYIIGGALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSM 95
            |...:.|.|.:|.|..  :....:|:|.||.| :..:|.|..||||......|.||::...::.:
  Fly    78 GPLTLLNNGHTAHVEIPETANGNKPFITGGLL-KGRFVAEAFHFHWGSPSSRGSEHSINQQRFDV 141

  Fly    96 EAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGEKD--CPEFKKITEGIRIVQKIHTSASLDS 158
            |.|.||.|.||.|..|||||.||:||:...::.....:  .|...|:...:..|.|.:...::..
  Fly   142 EMHIVHRNEKYGDIDEAKNKKDGIAVIGVMLKIVKNPNRIFPGLSKVMSALPRVTKYNAKTTIPG 206

  Fly   159 DCLSWIGLQEL-----SKHYYTYKGSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDE 218
            .    :.|.::     .:.::||:|||||....:||||.::...:.|....|..|..|:.   .|
  Fly   207 G----LSLGQMLGNVNPRDFFTYRGSLTTPLCEQSVTWTVFSQVLPVPYSSVSKFWKLRD---SE 264

  Fly   219 SKKIVNNYREIQRPHKDPEIFF 240
            ..:::||:|:|| |.....:|:
  Fly   265 GHRLINNFRDIQ-PRNGRPVFY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 62/208 (30%)
CAH6NP_001097987.1 Carb_anhydrase 30..282 CDD:215000 63/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.