DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH4

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_651298.1 Gene:CAH4 / 42965 FlyBaseID:FBgn0039235 Length:279 Species:Drosophila melanogaster


Alignment Length:245 Identity:76/245 - (31%)
Similarity:123/245 - (50%) Gaps:22/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEI-SNRAIE-HIDDVDPLEYH-GHWEPVGVARVQNTGTSAMVTFSKR--KQQPYIIGGALE 63
            ||||.: |..||. ::..:..|.|| ...:|:.|.   |.|.:.::...|.  ..:|.:......
  Fly    38 QSPIALWSCNAITCNVPKLKFLNYHKSLCDPLSVI---NNGLTVLMRIPKTVDGSRPSLCISTEG 99

  Fly    64 QDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQA 128
            |.::..:||||||......|.||.|:|..|..|.|.||.|:.||...||..:|:|.||:|.||:.
  Fly   100 QQVFEADQLHFHWGSALSKGSEHCLDGNYYDGEVHIVHKNASYKSNKEAGLQPNGFAVLALFIRN 164

  Fly   129 CGEK--DCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQEL-----SKHYYTYKGSLTTAPYF 186
            ..:.  :.|....|.:.:..:.|:..|..|:..    :.||:|     |:.|:||:|||||.|..
  Fly   165 LEDPNIETPAMNMICKQVSSITKLDDSCPLEDS----MALQDLFASIDSQKYFTYQGSLTTPPCA 225

  Fly   187 ESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKDP 236
            |:|.|.::.||:.|.:   :::::.........::::|.|||:|..|..|
  Fly   226 EAVIWFVFPTPLDVPK---ELWKHFWQLRDSRDQRVLNTYRELQDGHDRP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 74/240 (31%)
CAH4NP_651298.1 alpha_CA 35..274 CDD:238200 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.