DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH8

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001262833.1 Gene:CAH8 / 42625 FlyBaseID:FBgn0038956 Length:303 Species:Drosophila melanogaster


Alignment Length:268 Identity:74/268 - (27%)
Similarity:114/268 - (42%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNR-AI-------------EHIDDVDPLEYHGHW----EPVGVARVQNTGTSAMVTFSK 50
            ||||.||.| ||             |..|::..:...||.    .|..:..|             
  Fly    48 QSPIAISRRKAIPLNLPPLIFALYDEFFDELVTIRNSGHTVEFKVPTTIYGV------------- 99

  Fly    51 RKQQPYIIGGALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNK 115
               :||:.||.| :|.|..|.:||||...:..|.||.|.|.::.:|.|.||.|:||.:..||...
  Fly   100 ---KPYVTGGLL-RDCYDAEAVHFHWGSPESKGSEHLLNGRRFDLEMHIVHRNTKYLNLEEAVKY 160

  Fly   116 PDGLAVVA----------FFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELS 170
            .||:.|:|          ||.|       |...:|...:..:...:.|.::.........|..|.
  Fly   161 SDGVTVLAVLFKVVRSGPFFYQ-------PGLSEIFSSLLHLGNFNASYTVQERLTLGSLLGSLD 218

  Fly   171 K-HYYTYKGSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHK 234
            : ::|||||||||.|....|.|.::...:.:|...:..|.||:.   :..:.::.|:|.:|  .:
  Fly   219 RGNFYTYKGSLTTPPCSPVVQWHVFGEVLPISHQDLPKFWNLRD---ERGRPLLKNFRPLQ--SQ 278

  Fly   235 DPEIFFAR 242
            :..:.|.|
  Fly   279 ENRLIFHR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 72/257 (28%)
CAH8NP_001262833.1 Carb_anhydrase 31..281 CDD:215000 72/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.