DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH2

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster


Alignment Length:241 Identity:77/241 - (31%)
Similarity:118/241 - (48%) Gaps:13/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDP-LEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQ-PYIIGGALEQDM 66
            ||||.|..  :..::...| ||:..........::.|.|.:.:|..|..:.: |.:.||.|.:..
  Fly    51 QSPINIDQ--VSAVEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVKMSYNEDEIPSVRGGPLAEKT 113

  Fly    67 ---YVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQA 128
               |.|||.||||.:.|..|.|..:....|..|.|.|..|.:|.||..|.:|..|:||:|||.|.
  Fly   114 PLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQV 178

  Fly   129 CGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWII 193
             |:|....::..|..:..:.:...|.::.:.......:.:..:.|::|.|||||.|..|.||||.
  Fly   179 -GDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWID 242

  Fly   194 YRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQRPHKDPEIF 239
            :.|||.::..|:..||.|.:  .|:..|  ||:|.|| |..|..::
  Fly   243 FTTPIDITEKQLNAFRLLTA--NDDHLK--NNFRPIQ-PLNDRTLY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 75/233 (32%)
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 77/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.