DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca2

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_954685.2 Gene:ca2 / 387526 ZFINID:ZDB-GENE-031219-5 Length:260 Species:Danio rerio


Alignment Length:241 Identity:82/241 - (34%)
Similarity:123/241 - (51%) Gaps:34/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||:|.:....:.:.:.||:.  .::|.....:||.|.|..|:|...:....:.||.: ...:.
Zfish    28 QSPIDIKSSTTTYDEKLTPLKL--KYDPSTSLDIQNNGHSFQVSFVDDQNSSTLTGGPV-TGTFR 89

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGEKD 133
            .:|.||||...|:.|.|||:.|..|..|.|.||:|:||..|.:|.:||||||||..|::.  ..|
Zfish    90 LKQFHFHWGSADDKGSEHTVNGKCYPAELHLVHWNTKYPSFKDAVDKPDGLAVVGVFLKI--GAD 152

  Fly   134 CPEFKKITEGIRIVQ-------------KIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPY 185
            .|:.:||.:.:..::             .:...:|||               |:||.|||||.|.
Zfish   153 NPKLQKILDAMDAIKSKGKQTPFPNFDPSVLLPSSLD---------------YWTYLGSLTTPPL 202

  Fly   186 FESVTWIIYRTPIYVSRGQVQVFRNLQ-SCPKDESKKIVNNYREIQ 230
            .||||||:.:..|.||..|::.||:|. |...:::..:|||||..|
Zfish   203 LESVTWIVCKQSISVSSAQMKRFRSLLFSGDGEKACCMVNNYRPPQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 82/241 (34%)
ca2NP_954685.2 alpha_CA 1..259 CDD:320708 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.