DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH14

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_611519.2 Gene:CAH14 / 37359 FlyBaseID:FBgn0034554 Length:295 Species:Drosophila melanogaster


Alignment Length:213 Identity:42/213 - (19%)
Similarity:77/213 - (36%) Gaps:32/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HWE-----PVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYVFEQLHFHWSDCDESGCEHT 87
            ||.     |:......|..|..|..::.....|.:.|..| ...|.|.:..|.|.....   ||:
  Fly    93 HWTYYEDLPMATVLENNGNTVIMRIYTANNFMPQLSGAEL-LGRYQFVEAIFKWGSLKS---EHS 153

  Fly    88 LEGMKYSMEAHAVH----YNSKYKDFTEAKNKPDGLAVVAFFIQACGEKDCPEFKKITEGIRIVQ 148
            :....:.:|..|:|    .|:.::..|.:            ::.|.........|::|:.::.:.
  Fly   154 IGKHNFCLELQALHRCAQLNNNFEYLTLS------------YLFALSHVKNEHLKQVTDHLKWIS 206

  Fly   149 KIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYRTPIYVSRGQVQVFRNL-- 211
            :..:|..|....|..: ||.....|::|:|:..........||:|.|....|...|:..|..|  
  Fly   207 QPGSSIELPPFHLESL-LQPFGSGYFSYEGTYDNGDVVLPTTWLINRKISVVDSRQLSEFEALYG 270

  Fly   212 ----QSCPKDESKKIVNN 225
                ::|.....|:.:.|
  Fly   271 RNGNRNCKNGREKQPLGN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 42/213 (20%)
CAH14NP_611519.2 alpha_CARP_receptor_like 69..293 CDD:239396 42/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.