DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Ca12

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001074225.1 Gene:Ca12 / 363085 RGDID:1306612 Length:354 Species:Rattus norvegicus


Alignment Length:241 Identity:76/241 - (31%)
Similarity:124/241 - (51%) Gaps:26/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQSPIEISNRAIEHIDDVDPLEYHGHWEPVGVAR---VQNTGTSAMVTFSKRKQQPYIIGGALEQ 64
            :||||::.:..:::...:.||::.|:  .|.|.:   :.|.|.|..:..:   ...||.|  |:.
  Rat    54 LQSPIDLHSDILQYDASLAPLQFQGY--NVSVEKLLNLTNDGHSVRLNLN---SDMYIQG--LQP 111

  Fly    65 DMYVFEQLHFHWSD-CDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFIQ 127
            ..|..||||.||.: .|..|.|||:.|..::.|.|.|||||. |.||..|.:|.:||||:|..|:
  Rat   112 HQYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYSDFGSASDKSEGLAVLAVLIE 176

  Fly   128 ACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQEL----SKHYYTYKGSLTTAPYFES 188
             .|..: |.:.||...::     |.........:....::||    ...||.|:|||||.|.:.:
  Rat   177 -IGSVN-PSYDKIFSHLQ-----HVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPT 234

  Fly   189 VTWIIYRTPIYVSRGQVQVFRN-LQSCPKDE--SKKIVNNYREIQR 231
            |.|.::|.|:.:|:.|:..... |.....|:  .:::|||:|::|:
  Rat   235 VLWTVFRNPVQISQEQLLALETALYFTHMDDPSPREMVNNFRQVQK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 76/240 (32%)
Ca12NP_001074225.1 alpha_CA 39..290 CDD:294017 76/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.