DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CAH1

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster


Alignment Length:234 Identity:83/234 - (35%)
Similarity:124/234 - (52%) Gaps:17/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDD--VDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDM 66
            |||::|:..:.:...:  |.||::  .:.|.....:.|.|....|..:....:  :.||.|...:
  Fly    28 QSPVDITPSSAKKGSELNVAPLKW--KYVPEHTKSLVNPGYCWRVDVNGADSE--LTGGPLGDQI 88

  Fly    67 YVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYN-SKYKDFTEAKNKPDGLAVVAFFIQACG 130
            :..||.|.||...|..|.|||::|:.||.|.|.||:| :|||.|.||...||||||:..|::|..
  Fly    89 FKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKYKSFGEAAAAPDGLAVLGVFLKAGN 153

  Fly   131 EKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYR 195
            ..  .|..|:|..::.|.......:|...|.....|.::.. |:||:|||||.|..|||.||:::
  Fly   154 HH--AELDKVTSLLQFVLHKGDRVTLPQGCDPGQLLPDVHT-YWTYEGSLTTPPCSESVIWIVFK 215

  Fly   196 TPIYVSRGQVQVFRNL------QSCPKDE-SKKIVNNYR 227
            |||.||..|:...|||      :.||.:| :.|::||:|
  Fly   216 TPIEVSDDQLNAMRNLNAYDVKEECPCNEFNGKVINNFR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 83/234 (35%)
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 83/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.