DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and CARPB

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001245593.1 Gene:CARPB / 31915 FlyBaseID:FBgn0052698 Length:327 Species:Drosophila melanogaster


Alignment Length:258 Identity:72/258 - (27%)
Similarity:118/258 - (45%) Gaps:19/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSK-------RKQQPYIIGGA 61
            |||:.:..:.:....::.|:....| ...|:  :.|||.|.:.|...       ..|.|..|.|.
  Fly    57 QSPVNLEPQRLLFDPNLRPMHIDKH-RISGL--ITNTGHSVIFTAGNDTVANYDGMQTPVNISGG 118

  Fly    62 LEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFF 125
            .....|.|.::|.|:...|:.|.||::||..:..|.....|||: |.:|::|.|:..|:..|:..
  Fly   119 PLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYNSQLYANFSDALNRAQGIVGVSIL 183

  Fly   126 IQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVT 190
            :| .|:....|.:.:|:.:..::.....|.:..  ||..||...:.||.||.||.|.....|:||
  Fly   184 LQ-LGDLSNAELRMLTDQLERIRYGGDEAFVKR--LSIRGLLPDTDHYMTYDGSTTAPACHETVT 245

  Fly   191 WIIYRTPIYVSRGQVQVFRNL-QSCPKDESKKIVNNYRE----IQRPHKDPEIFFARNTNPKS 248
            |::...|||:::.|:...|.| |..|......:.||||.    :.||.:....|....:|.|:
  Fly   246 WVVLNKPIYITKQQLHALRRLMQGSPDHPKAPLGNNYRPPQPLLHRPIRTNIDFKTTKSNGKA 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 68/241 (28%)
CARPBNP_001245593.1 alpha_CARP_X_XI_like 37..298 CDD:239395 69/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.