DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Ca11

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_783639.1 Gene:Ca11 / 308588 RGDID:735155 Length:328 Species:Rattus norvegicus


Alignment Length:273 Identity:62/273 - (22%)
Similarity:114/273 - (41%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNT--GTSAMVTFSKRKQQPYIIGGALEQDM 66
            |||:::..:.:.:...:.||..     ..|..:::.|  .|...|:|....:....:.|......
  Rat    68 QSPVDVELKRVLYDPFLPPLRL-----STGGEKLRGTLYNTGRHVSFLPASRPVVNVSGGPLLYS 127

  Fly    67 YVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFIQACG 130
            :...:|...:...|.:|.||.:....:|.|...:|:|.: |.:.:.|...|:|||:::.|:...|
  Rat   128 HRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVAG 192

  Fly   131 EKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIG-------LQELSKH--------YYTYKGSL 180
            ..: |...::               |:.|.::.|.       ||:||..        :.||:|||
  Rat   193 SSN-PFLSRL---------------LNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSL 241

  Fly   181 TTAPYFESVTWIIYRTPIYVSRGQVQVFRNL-QSCPKDESKKIVNNYREIQ-------RPHKDPE 237
            :|.|..|:||||:....:.::..|:...|.| |:.|....:.:..|.|.:|       |.::||.
  Rat   242 STPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALRGNRDPR 306

  Fly   238 IFFARNTNPKSKL 250
            ....|...|..:|
  Rat   307 HPERRCRGPNYRL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 57/254 (22%)
Ca11NP_783639.1 alpha_CARP_X_XI_like 48..304 CDD:239395 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.