DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Ca8

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:221 Identity:68/221 - (30%)
Similarity:109/221 - (49%) Gaps:25/221 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGV----ARVQNTGTSAMVTFSKRKQQPYIIGGALEQ 64
            ||||.:::|...:    ||........|..|    ..|.|.|.:..|..   |.:..:.||.|.|
  Rat    49 QSPINLNSREARY----DPSLLDVRLSPNYVVCRDCEVTNDGHTIQVIL---KSKSVLSGGPLPQ 106

  Fly    65 ----DMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAF 124
                ::|   ::.|||...::.|.|||:....:.||.|.:|:||. :....||..||.|:.::|.
  Rat   107 GQEFELY---EVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIVIIAL 168

  Fly   125 FIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGL--QELSKHYYTYKGSLTTAPYFE 187
            |:|.  .|:....|.:||.::.:|  :...|....|.:...|  ..|.:.|:.|:||||..|..|
  Rat   169 FVQI--GKEHVGLKAVTEILQDIQ--YKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSE 229

  Fly   188 SVTWIIYRTPIYVSRGQVQVFRNLQS 213
            .||||::|.|:.:|:.|::.||.|::
  Rat   230 GVTWILFRYPLTISQLQIEEFRRLRT 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 68/221 (31%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 68/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.