DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Car15

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:250 Identity:74/250 - (29%)
Similarity:114/250 - (45%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVQSPIEISNRAIEHIDDVDPLEYHGH-------WEPVGVARVQNTGTSAMVTFSKRKQQ-PYII 58
            |.|||:.|..|.::....:.|..:||:       |      .::|.|.:.::.....:|. |.|.
  Rat    48 PTQSPVNIDLRLVQRDYALKPFIFHGYDSAPQDPW------ILENDGHTVLLRVHSCQQNCPAIR 106

  Fly    59 GGALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVA 123
            |..|....|...||||||......|.||:::....|||.|.||.|:||:....|:::|||||::|
  Rat   107 GAGLPSSEYRLLQLHFHWGSPGHKGSEHSVDEKHGSMEMHMVHMNTKYQSMGHARSQPDGLAILA 171

  Fly   124 FFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCL------SWIGLQELSKHYYTYKGSLTT 182
            ..:.. .:||...|..|..|::.|.....|.:|.|...      |.:||    ..||.|.|||||
  Rat   172 VLLVE-EDKDNTNFSAIVSGLKNVSSPGVSVNLTSTFALASLLPSALGL----LRYYRYSGSLTT 231

  Fly   183 APYFESVTWIIYRTPIYVSRGQVQVFRNLQSCPKD-----ESKKIVNNYREIQRP 232
            .....:|.|.::...:.:...||..|   |:.|:.     ..:.:.:|:|. |:|
  Rat   232 PGCEPAVLWTVFENTVPIGHAQVVQF---QAVPQTGPPGLHPRPLTDNFRP-QQP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 72/247 (29%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.