DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Car14

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006501505.1 Gene:Car14 / 23831 MGIID:1344341 Length:460 Species:Mus musculus


Alignment Length:243 Identity:71/243 - (29%)
Similarity:116/243 - (47%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGH----WEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQ 64
            ||||.|...::....|:..::.||:    .||:.   :.|.|.:..::.     .|.:..|.|.:
Mouse    45 QSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLD---LHNNGHTVQLSL-----PPTLHLGGLPR 101

  Fly    65 DMYVFEQLHFHWSDCDE-SGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVAFFIQ 127
             .|...|||.||..... .|.||.:.....:.|.|.|||:|: |...:||..||.||||:...|:
Mouse   102 -KYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIE 165

  Fly   128 ACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWI 192
            . ||.:.|.:..|...:..::......|:....:..:..|:| :.::.|.|||||.|.::||.|.
Mouse   166 V-GETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQL-EQFFRYNGSLTTPPCYQSVLWT 228

  Fly   193 IYRTPIYVSRGQVQVFR-NLQSCPKDESKKIVNNYREIQRPHKDPEIF 239
            ::.....:|.||::..: .|.|..:|.|:.:|.||| :.:|.....||
Mouse   229 VFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYR-VPQPLNQRTIF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 68/235 (29%)
Car14XP_006501505.1 alpha_CA_XII_XIV 29..278 CDD:239400 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.