DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and cah-6

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_491189.1 Gene:cah-6 / 189049 WormBaseID:WBGene00000284 Length:319 Species:Caenorhabditis elegans


Alignment Length:235 Identity:59/235 - (25%)
Similarity:111/235 - (47%) Gaps:11/235 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEI---SNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQD 65
            ||||:|   .....||:.:.   .:...:|..|..:..|.|.|  :...:......:....|.::
 Worm    68 QSPIDIVPVITAFGEHLQNA---HFEVTYESTGEFKAVNDGNS--IWLMREGNSSELAISFLPEE 127

  Fly    66 MYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACG 130
            .|..:.::|||:....:|.|||:.|:.|:.|.|.:|.|:::....:|..:|:|:..:|.|:....
 Worm   128 QYHLDAVNFHWATEPMNGSEHTIGGVGYAGEMHLIHRNTRFATMADALKQPNGVIAIAVFLNESH 192

  Fly   131 EKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWIIYR 195
            :.:......|....:::.|.........|..::..:.|.:|.::.|:||.||.|:.|:|.||:.|
 Worm   193 DDNAVFSPLINLLPQVIYKGSECKLCSFDFQTFFPVAEKTKEFWMYEGSETTDPFRETVNWIVIR 257

  Fly   196 TPIYVSRGQVQVFRNLQSCPKDE--SKKI-VNNYREIQRP 232
            ..:.:|..|:...|.:::...||  |.|: :...|.||.|
 Worm   258 AALPISSHQLDKLREVRAGRYDEEFSDKVPMKPLRPIQNP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 59/235 (25%)
cah-6NP_491189.1 alpha_CARP_receptor_like 56..304 CDD:239396 59/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.