DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and cah-1

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001309492.1 Gene:cah-1 / 186231 WormBaseID:WBGene00000279 Length:303 Species:Caenorhabditis elegans


Alignment Length:238 Identity:69/238 - (28%)
Similarity:109/238 - (45%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQSPIEISNRAIEHIDDVDPLEYHGHWEPVG------VARVQNTGTSAMVT--FSKRKQQPYIIG 59
            :||||:|         ..|.|.:....:||.      |:...|||....|.  :|.:|....|..
 Worm    58 LQSPIDI---------QPDRLLFDASVKPVRLDKLPVVSEFVNTGQMVRVRIGYSSKKPSVNITS 113

  Fly    60 GALEQDMYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSK-YKDFTEAKNKPDGLAVVA 123
            |.|....|..:::.||....:|:|.|||:.|.::.||...|.||:. |.:||.|...|.|:|:::
 Worm   114 GPLYGYRYRVQRIDFHMGRKNENGSEHTINGRRFPMEVQLVAYNTDLYPNFTSASKSPHGIAILS 178

  Fly   124 FFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFES 188
            ..:. .|.:...|..|:|.....:........| :|...| .|...::...||:||||:....|:
 Worm   179 VLVD-FGPETNQELIKLTIATASISYKDQRVQL-ADFEPW-RLLPFTRDIITYEGSLTSPGCHET 240

  Fly   189 VTWIIYRTPIYVSRGQVQVFRNLQ-SCPKDESKKIVNNYREIQ 230
            |||||...||::.:...:.:.:|. |....|...:..|:|:||
 Worm   241 VTWIILNQPIFIKKEHFEEWSHLYLSMEGAEKVPVAPNFRKIQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 69/237 (29%)
cah-1NP_001309492.1 alpha_CARP_X_XI_like 39..295 CDD:239395 69/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.