DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and cah-3

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001370788.1 Gene:cah-3 / 181713 WormBaseID:WBGene00000281 Length:246 Species:Caenorhabditis elegans


Alignment Length:240 Identity:78/240 - (32%)
Similarity:110/240 - (45%) Gaps:43/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||.|....:|..|..|.:::..:..|: ...:.|.|.|..:|...|.:.|.|.||.|:| :|.
 Worm    24 QSPINIDLGEVERKDTHDGIKFVNYDHPI-QGDIVNNGHSVQMTPELRSEHPEIYGGGLDQ-VYR 86

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGE-- 131
            ..|.||||.:.|..|.||||.|::|..|.|.||         :....|..||||..|:|...|  
 Worm    87 LVQYHFHWGENDNEGSEHTLGGLRYPAELHLVH---------QGVEDPGKLAVVGVFLQLGKEGK 142

  Fly   132 ----------KDC-PEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPY 185
                      |.| ||.....|.:|:.:|:..:                .:.::.|:|||||.|.
 Worm   143 ALSNEERVLGKLCNPETVTRVENVRLSEKLPAN----------------KRSFWRYEGSLTTPPC 191

  Fly   186 FESVTWIIYRTPIYVSRGQVQVFRNLQSCPKDESKKIVNNYREIQ 230
            .|.|||.|:..|:.|:..|:::||.:|...|...||   |||..|
 Worm   192 SEIVTWTIFTEPVTVTHDQLELFRQVQDIEKRPIKK---NYRPTQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 78/240 (33%)
cah-3NP_001370788.1 Carb_anhydrase 5..239 CDD:215000 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.