DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and Car3

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_031632.2 Gene:Car3 / 12350 MGIID:88270 Length:260 Species:Mus musculus


Alignment Length:234 Identity:78/234 - (33%)
Similarity:116/234 - (49%) Gaps:20/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            |||||:..:.|:|...:.|  :...::|.....:.|.|.:..|.|.....:..:.||.| ...|.
Mouse    28 QSPIELHTKDIKHDPSLQP--WSASYDPGSAKTILNNGKTCRVVFDDTYDRSMLRGGPL-SGPYR 89

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQACGEKD 133
            ..|.|.||...|:.|.|||::|:||:.|.|.||:|.||..|.||..:|||:|||..|::...||.
Mouse    90 LRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFGEALKQPDGIAVVGIFLKIGREKG 154

  Fly   134 CPEFKKITEGIRIVQKIHTSAS------LDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWI 192
              ||:.:.:.:   .||.|...      .|..||.     ...:.|:||.||.||.|..|.:.|:
Mouse   155 --EFQILLDAL---DKIKTKGKEAPFTHFDPSCLF-----PACRDYWTYHGSFTTPPCEECIVWL 209

  Fly   193 IYRTPIYVSRGQVQVFRNLQSCPKDESK-KIVNNYREIQ 230
            :.:.|:.||..|:...|:|.|..::|.. .:|.|:|..|
Mouse   210 LLKEPMTVSSDQMAKLRSLFSSAENEPPVPLVGNWRPPQ 248

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 78/234 (33%)
Car3NP_031632.2 alpha_CA_I_II_III_XIII 1..259 CDD:239393 78/234 (33%)
Involved in proton transfer. /evidence=ECO:0000250 64..67 0/2 (0%)