DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and si:ch211-173d10.4

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_021336146.1 Gene:si:ch211-173d10.4 / 108191769 ZFINID:ZDB-GENE-121214-331 Length:234 Species:Danio rerio


Alignment Length:194 Identity:58/194 - (29%)
Similarity:83/194 - (42%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GGALEQDMYVFEQLHFHWSDCD---ESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLA 120
            ||.|:. .|...|.||||...|   :.|.||:|...::.:|.|.|...:...| :.|...|||.|
Zfish    24 GGGLKH-KYTVLQFHFHWGGRDPRQQPGSEHSLNRHRWPVEMHIVSRRTDLND-SAASRVPDGFA 86

  Fly   121 VVAFFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQEL-----SKHYYTYKGSL 180
            |:.|||..........::...|.::.:.:...:..:..|    |.||:|     ...||.|.|||
Zfish    87 VMGFFIDGKENVTSQVWENFMEYLQKIPRKGDTVRITDD----ISLQQLLTGVDLSRYYRYSGSL 147

  Fly   181 TTAPYFESVTWIIYRTPIYVSRGQV---------QVFRNLQSCPK-----------DESKKIVN 224
            ||.|..|:|.|.:::.||.:|..|:         .|:|..||..|           |.|...||
Zfish   148 TTPPCDEAVQWTVFKDPIIISTDQLLRFQTVSFGYVYRPQQSLNKRTVYASAALAADASSSAVN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 58/194 (30%)
si:ch211-173d10.4XP_021336146.1 alpha_CA 1..196 CDD:320708 54/177 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.