DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca12

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009296363.1 Gene:ca12 / 100537787 ZFINID:ZDB-GENE-080815-4 Length:505 Species:Danio rerio


Alignment Length:253 Identity:79/253 - (31%)
Similarity:113/253 - (44%) Gaps:51/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||:.....:.:..::.|::...:          |..||..:|.........:   :|...||:
Zfish    45 QSPIDFQTHLLRYDPNLPPIQVQNY----------NLSTSEQLTLGNNGHSVQL---SLPSHMYI 96

  Fly    69 FE--------QLHFHWSDCD-ESGCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVA 123
            ..        ||||||...: .:|.|||:.|.:::.|.|.||:|| ||.:.:.|.:|.|||||:.
Zfish    97 SSLPHRYSAAQLHFHWGSSNLLTGSEHTVNGKQFAGEMHVVHFNSDKYPNVSMAVDKHDGLAVLG 161

  Fly   124 FFIQACGEKDCPEFKKITEGIRIV----QKIHTSA----SLDSDCLSWIGLQELSKHYYTYKGSL 180
            .||: .||.: |.|.|:...|..|    |||...|    :|..|.|.         .||.|.|||
Zfish   162 VFIE-IGEAN-PAFDKLFRFISGVKYRDQKIQVPAFNIRALLPDRLD---------QYYRYDGSL 215

  Fly   181 TTAPYFESVTWIIYRTPIYVSRGQVQVFRN------LQSCPKDESKKIVNNYREIQRP 232
            ||.|.:.||.|.::|.|:.:||.|......      .|..|   |..:..|||:.|.|
Zfish   216 TTPPCYPSVLWTVFRKPVTISRKQFLALATALYASFAQDSP---SMPLHENYRKSQLP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 79/253 (31%)
ca12XP_009296363.1 alpha_CA 29..279 CDD:294017 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.