DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca1

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_002939198.1 Gene:ca1 / 100496485 XenbaseID:XB-GENE-957160 Length:262 Species:Xenopus tropicalis


Alignment Length:241 Identity:80/241 - (33%)
Similarity:124/241 - (51%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISN---RAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQD 65
            ||||::.:   :|.|.:..:. :.|:..    .:..:.|.|.|..| .::.|:.|.::.....:.
 Frog    29 QSPIDVKSGEAKADESLKSLS-IRYNSD----SIKSLVNVGHSFQV-LAEDKENPSVVAQGPLKA 87

  Fly    66 MYVFEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVAFFIQAC 129
            .|...|.||||...::.|.|||::|..|:.|.|.||:|| ||..|.||...|||.|||..||:..
 Frog    88 TYRLNQFHFHWGASNDFGSEHTVDGKGYAAELHLVHWNSDKYSSFAEASKNPDGCAVVTVFIKVG 152

  Fly   130 GEKDCPEFKKITEGIRIV-QKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWII 193
            ...  |..:::.|.:.:: .|...:|..:.|..:   |...|..|:||:||||..|..|.|||||
 Frog   153 SSH--PGLQRVVEALELIAAKGKQAAFTNFDAST---LLPASMDYWTYQGSLTHPPLLECVTWII 212

  Fly   194 YRTPIYVSRGQVQVFRN-LQSCPKDESKKIVNNYREIQRPHKDPEI 238
            ::.||..|..|:.:||. |.|...:|:..::.|:|..| |.|..|:
 Frog   213 FKEPISASSEQINLFRRILSSAEGEEACPVLANHRPTQ-PLKGREV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 77/234 (33%)
ca1XP_002939198.1 alpha_CA 2..261 CDD:381753 80/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.