DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and LOC100496280

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_002940642.4 Gene:LOC100496280 / 100496280 -ID:- Length:313 Species:Xenopus tropicalis


Alignment Length:239 Identity:67/239 - (28%)
Similarity:109/239 - (45%) Gaps:27/239 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYIIGGALEQDMYV 68
            ||||.|.:.::::...:....:..:.:...:..:.|.|.:..|..:....   :.||.| ...|.
 Frog    44 QSPINIVDASVQYNASLGTFTFTNYGDSSKLVLLNNPGHTVEVQLASGVT---LSGGGL-PSTYS 104

  Fly    69 FEQLHFHWSDCDESGCEHTLEGMKYSMEAHAVHYNSKYKDFTEAKNKPDGLAVVAFFIQ-ACGEK 132
            ....||||.:..::|.||.|.|.::.||.|.|| .....:.|.||..|:|:||:.|||. .....
 Frog   105 AVAFHFHWGNTSQNGSEHQLGGRQFPMEMHIVH-TKNGMNLTAAKQDPNGIAVLGFFIDVGTSSS 168

  Fly   133 DCPEFKKI-----TEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLTTAPYFESVTWI 192
            ..|....:     ..|..|.  ::.|.|:|    |.:|..:.:. ||.|.|||||....|:|.|.
 Frog   169 KLPTLASLLVNVSNAGTNIT--LNGSFSID----SILGAVDRTS-YYRYLGSLTTPTCDEAVVWT 226

  Fly   193 IYRTPIYVSRGQVQ-----VFRNLQSCPKDESKKIVNNYREIQR 231
            ::|.||.|....:|     ::.|....|::    :|||:|.:|:
 Frog   227 VFRNPILVPASVIQNFSSNIYLNSTGSPQN----MVNNFRILQQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 67/239 (28%)
LOC100496280XP_002940642.4 alpha_CA 41..272 CDD:412109 67/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.