DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca14

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001103521.1 Gene:ca14 / 100126213 XenbaseID:XB-GENE-855636 Length:343 Species:Xenopus tropicalis


Alignment Length:247 Identity:78/247 - (31%)
Similarity:119/247 - (48%) Gaps:42/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMVTFSKRKQQPYII---GGALEQD 65
            ||||.|....|.:.:.:.|:|..|:..|                    ..||:.:   |.::|..
 Frog    44 QSPINIQTSNISYDESLPPIEPEGYNTP--------------------GNQPFTLTNNGHSVELS 88

  Fly    66 M------------YVFEQLHFHW-SDCDESGCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKP 116
            :            :...|||.|| |...::|.||.|:|.::..|.|.||||| ||.|.:||||||
 Frog    89 LPSSMTLRGLPNTFKAAQLHLHWGSPAKQAGSEHRLDGEEFPAELHIVHYNSDKYADISEAKNKP 153

  Fly   117 DGLAVVAFFIQACGEKDCPEFKKITEGIRIVQKIHTSASLDSDCLSWIGLQELSKHYYTYKGSLT 181
            |||||:..|.: .|..|.|.:..|...:..::....:.|:.|..:..: |.|..:.|:.|:||||
 Frog   154 DGLAVLGVFFE-IGATDNPAYANILHHLDNIRYKDQTVSVPSFNVRHL-LPENLEEYFRYQGSLT 216

  Fly   182 TAPYFESVTWIIYRTPIYVSRGQVQVFR-NLQSCPKDE--SKKIVNNYREIQ 230
            |.|.::||.|.::..|:.:||.|::..: .|.|....|  .:.:.||.||.|
 Frog   217 TPPCYQSVLWTVFYHPVEISRSQLEKLQTTLYSTTATEVPPEVLGNNVREAQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 78/247 (32%)
ca14NP_001103521.1 alpha_CA 28..279 CDD:294017 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.