DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH3 and ca6

DIOPT Version :9

Sequence 1:NP_001259349.1 Gene:CAH3 / 31804 FlyBaseID:FBgn0030056 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_009295179.1 Gene:ca6 / 100006448 ZFINID:ZDB-GENE-030131-7091 Length:538 Species:Danio rerio


Alignment Length:236 Identity:89/236 - (37%)
Similarity:126/236 - (53%) Gaps:24/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSPIEISNRAIEHIDDVDPLEYHGHWEPVGVARVQNTGTSAMV----TFSKRKQQPYIIGGALEQ 64
            ||||:|..|.:.:...:..||..|:.:..|...::|.|.|..:    |....|..|:        
Zfish    49 QSPIDIQRRKVRYSPRMQQLELTGYEDIRGSFLMKNNGHSVEIQLPSTMKITKGFPH-------- 105

  Fly    65 DMYVFEQLHFHWS--DCDESGCEHTLEGMKYSMEAHAVHYNS-KYKDFTEAKNKPDGLAVVAFFI 126
             .|...|:|.||.  |.:.||.|||::|::|..|.|.||||| ||..|.|||||||||||:|||.
Zfish   106 -QYTAVQMHLHWGGWDLEASGSEHTMDGIRYMAELHVVHYNSEKYPSFEEAKNKPDGLAVLAFFF 169

  Fly   127 QACGEKDCPEFKKITEGIRIVQKIHTSASLDS-DCLSWIGLQELSKHYYTYKGSLTTAPYFESVT 190
            :. |..:...:......:..::.:..|.|:.: :.||.  |.|...|:|.|||||||.|.||||.
Zfish   170 ED-GHFENTYYSDFISNLANIKYVGQSMSISNLNVLSM--LSENLSHFYRYKGSLTTPPCFESVM 231

  Fly   191 WIIYRTPIYVSRGQVQVFRNLQSCPKD-ESKKIVNNYREIQ 230
            |.::.|||.:|..|:   |.|:|...| ::|.:.|:||..|
Zfish   232 WTVFDTPITLSHNQI---RKLESTLMDHDNKTLWNDYRMAQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH3NP_001259349.1 alpha_CA 4..233 CDD:238200 89/236 (38%)
ca6XP_009295179.1 alpha_CA 33..281 CDD:320708 89/236 (38%)
LamG 332..521 CDD:328935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.