DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32448 and Smim8

DIOPT Version :10

Sequence 1:NP_730691.2 Gene:CG32448 / 318032 FlyBaseID:FBgn0052448 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_079747.1 Gene:Smim8 / 66291 MGIID:1913541 Length:97 Species:Mus musculus


Alignment Length:85 Identity:27/85 - (31%)
Similarity:42/85 - (49%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEGKQQGPGDGIRSMRSTGVFRLINFELYTKPNKIIMGLGLTAIAGVFGYIAYMRYKYES-LGY 64
            :.|...:.|  |:|...:|.:||.:|.||:.||||.:|..||..::....||.|:....|: ...
Mouse    15 LKEKNFENP--GLRGAHTTTLFRAVNPELFIKPNKPVMAFGLVTLSLCVAYIGYLHATQENRKDL 77

  Fly    65 YVAVQENGQEKFIKKKSNWE 84
            |.|:...|.....:|.|.|:
Mouse    78 YEAIDSEGHRYMRRKTSKWD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32448NP_730691.2 DUF4500 5..83 CDD:434330 25/78 (32%)
Smim8NP_079747.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 3/12 (25%)
DUF4500 16..96 CDD:434330 26/81 (32%)

Return to query results.
Submit another query.